ALPHAHEALTH FINDER
TreatmentsClinicsOnlineResources
Find Online Providers

Footer

ALPHAHEALTH FINDER

The men's-health clinic directory. 900+ vetted providers across 50 states. Built for operators 30 to 55.

Nationwide coverage · United States

Treatments

  • Testosterone Therapy
  • Sexual Health
  • Weight Management
  • Hair Restoration
  • IV Therapy
  • Advanced Therapies
  • Diagnostics & Testing
  • All Treatments

Locations

  • Browse All States
  • Texas Clinics
  • Florida Clinics
  • California Clinics
  • New York Clinics
  • Arizona Clinics

Online Providers

  • Online TRT
  • HRT
  • Online ED Treatment
  • Peptide Therapy
  • Weight Loss
  • Hair Loss
  • Blood Work
  • Mental Health

Resources

  • Find Clinics
  • Health Articles
  • List Your Clinic
  • Help Center

Company

  • About Us
  • Editorial Methodology
  • Contact
  • Privacy Policy
  • Terms of Service
  • Medical Disclaimer
  • Cookie Policy

Alpha Health Finder is a directory of independent clinics. We don’t provide medical advice or recommend specific treatments — those conversations belong with your doctor.

© 2026 Alpha Health Finder.

    1. Home
    2. Locations
    3. FL
    4. DeLand
    5. Serenity Wellness and Family Practice

    Serenity Wellness and Family Practice — TRT Clinic in DeLand, FL

    Reviewed byAHF Editorial Team·Updated July 2026

    5.0(172 reviews)DeLand, FLClosed
    (386) 873-4560

    Own Serenity Wellness and Family Practice?

    Claim This Listing
    Trusted Online Providers
    Verified
    PeterMD logo

    PeterMD

    America's Most Trusted Men's Health Clinic. Over 400,000 patients served with FDA-approved treatments for testosterone, ED, weight loss, and hair loss.

    44+ StatesVisit →
    Verified
    Fountain TRT logo

    Fountain TRT

    Modern TRT clinic focused on ease of use and rapid onboarding. Known for their "cream" based topical testosterone.

    45+ StatesVisit →
    Loading map...

    About Serenity Wellness and Family Practice

    Clinic Overview & Credentials

    Serenity Wellness and Family Practice has built something relatively uncommon in DeLand's primary care landscape: a clinic that combines conventional family medicine with a wide menu of wellness and aesthetic services, and has done so while maintaining a near-perfect patient satisfaction record across 172 verified Google reviews. The practice sits at 890 N Boundary Ave, Suite 101, in DeLand, FL 32720, and the breadth of what it offers, from hyperbaric oxygen therapy to medical weight loss to hormone optimization, positions it closer to an integrative wellness center than a traditional family practice. For patients who have grown frustrated with the assembly-line pace of conventional medicine, that combination appears to be a meaningful draw.

    The 4.95-star average across 172 reviews [source: Google] is not an artifact of a thin review pool. It reflects a sustained pattern, with reviews spanning from June 2023 through June 2026, and 170 of 172 ratings landing at five stars. That distribution is unusual enough to warrant attention.


    What Verified Reviews Actually Surface About This DeLand Practice

    The review data tells a specific story. Staff quality dominates the feedback: 131 of 172 reviewers, or 76.2 percent, flagged it as a defining characteristic of the experience. That is not a generic "everyone was nice" finding. Patients described the staff as caring, informative, and genuinely attentive in ways that distinguished the clinic from conventional medical offices.

    The second most prominent theme is subjective results, cited by 45 reviewers (26.2 percent). This is notable because results-based feedback is harder to earn than courtesy-based feedback. Patients are not just reporting that the visit was pleasant; they are reporting that something changed.

    Communication ranked third at 22.1 percent (38 reviewers), followed closely by prescriber quality at 20.9 percent (36 reviewers). Facility quality appeared in 29 reviews (16.9 percent), with patients consistently noting cleanliness and a relaxed environment. The intake process and scheduling each appeared in 13 and 12 reviews respectively, with scheduling drawing the only notable friction in the dataset: 2 of 12 scheduling-related reviews carried negative sentiment.

    “

    So happy to have found Serenity Wellness. Staff is outstanding, caring and very informative.

    N. S.·June 2026·Google
    “

    Best group of ladies and very comfortable environment while you are being taken care of. So many options to improve your well being !

    K. T.·May 2026·Google

    The prescriber quality theme deserves particular attention. Thirty-six reviewers specifically called out the clinical judgment and interpersonal quality of the providers, a category that tends to be underrepresented in wellness clinic reviews because patients often interact primarily with support staff. At Serenity Wellness, the providers themselves appear to be a primary driver of patient retention.


    The Services Menu: A Wide Range Under One Roof in DeLand

    The practice offers seventeen distinct services [source: serenitywellnessfamilypractice.com], spanning several clinical categories. On the wellness and recovery side: red light therapy, hyperbaric oxygen therapy, IV therapy, NAD+ therapy, glutathione infusions, and vitamin injections. Hormone health is represented through testosterone replacement therapy (TRT) and a broader sexual health and ED treatment offering. The weight management category is among the most developed, including medical weight loss protocols, B12 injections, lipotropic injections, and body composition analysis.

    Aesthetics and skin health round out the menu, alongside hair restoration and brain health services. For patients accustomed to managing multiple specialist relationships across different offices, the consolidation is a practical convenience. The facility at the DeLand location appears designed to accommodate that breadth without sacrificing the calm, spa-adjacent atmosphere that patients repeatedly mention in their reviews.

    “

    From scheduling ,cleanliness, bedside manners everything was excellent. The prices are very reasonable. I highly suggest Serenity for your Wellness. Treat Yourself 🌟

    S. R.·March 2026·Google

    Where the Practice Earns Its Strongest Marks: Prescriber and Support Team Quality

    Two staff members are named directly in the review data, which is worth noting because named-provider mentions in reviews typically indicate a level of trust that goes beyond transactional satisfaction. Michelle Tutt, identified as a provider, and Heather, identified as a nutrition-focused team member, both appear in detailed patient accounts.

    “

    Serenity Wellness is truly exceptional. Michelle Tutt is everything you could want in a provider — knowledgeable, compassionate, and genuinely invested in your health. She takes the time to listen, explains everything clearly, and makes you feel heard and supported rather than rushed. You always leave feeling confident in your care plan and reassured that you're in great hands.

    Q. F.·March 2026·Google

    The same reviewer continued: "I also have to highlight Heather, who is absolutely amazing. She is encouraging, approachable, and incredibly knowledgeable. Heather makes nutrition feel realistic and sustainable, breaking things down in a way that fits your lifestyle and goals without feeling overwhelming or judgmental."

    The perimenopausal and menopausal care thread in the reviews is particularly consistent. Multiple patients described arriving at the practice after being dismissed or underserved by other providers, and several used language suggesting the experience was a turning point in their care.

    “

    #1 for perimenopausal guidance…no other doctors would help me or look further in to what was going on. I feel great now and have my sanity back!

    F. 5.·March 2026·Google
    “

    I felt heard for the first time. And have hope for a normal day again. Menopause struggle is real!!

    s. a.·March 2026·Google

    This pattern, patients seeking care for hormonal symptoms after being turned away elsewhere, suggests the practice has developed a recognizable niche in women's health that goes beyond what the service list alone communicates.


    Results Patients Report: Weight Loss, Energy, and Hormonal Wellbeing

    Twenty-six percent of reviewers mentioned subjective results, and the specificity of those accounts is higher than typical wellness clinic reviews. The most detailed account in the dataset describes a weight loss outcome that is striking in its precision.

    “

    I started my weightloss journey at a morbidly obese weight (for my age and height) of 262lbs. My goal was to lose 100lbs in one year, however, within 6 months due their consistent rallying and guidance along with my dedication and perseverance ☆I was down 105lbs.

    C. S.·March 2026·Google

    This is a patient-reported outcome, not a clinical claim, and the reviewer explicitly credits both the team's support and her own commitment. That framing is consistent with how the practice appears to position its weight management work: as a guided process rather than a passive intervention. The combination of medical weight loss protocols, lipotropic and B12 injections, and body composition tracking suggests a structured approach with multiple touchpoints.

    Hormonal wellbeing outcomes appear in the prescriber quality and results themes simultaneously, with patients describing improvements in mood, energy, and daily function following treatment. Again, these are self-reported and vary by individual.


    Honest Breakdown: Low-Star Reviews and Where Friction Exists

    The review dataset contains only two one-star reviews out of 172, and zero reviews at two, three, or four stars. With fewer than five lower-star reviews in the dataset, a statistically grounded friction analysis is not possible. What the sentiment data does reveal is that the two categories with any negative sentiment are communication (2 negative out of 38 reviews) and scheduling (2 negative out of 12 reviews).

    Scheduling friction is the more structurally relevant finding. The practice is closed on Thursdays [source: clinic hours data], which reduces available appointment slots for patients with inflexible weekday schedules. Two reviewers flagged scheduling-related dissatisfaction, though the majority of scheduling-themed reviews were positive, with patients specifically praising flexibility and accommodation.

    For prospective patients, the practical implication is straightforward: if appointment availability or scheduling responsiveness is a priority concern, it is worth confirming current availability before committing to the practice as a primary care home.


    When Serenity Wellness in DeLand May Not Be the Right Fit

    The practice's model is built around integrative and elective wellness services layered onto a family practice foundation. Patients seeking a purely insurance-driven, high-volume primary care experience may find the environment and pace unfamiliar. The clinic does not appear to position itself as an urgent care or same-day walk-in facility.

    Patients whose primary need is acute or complex specialty care, cardiology, orthopedics, oncology, would likely use the practice as a complement to specialist relationships rather than a replacement. The service menu is broad but oriented toward preventive, hormonal, aesthetic, and metabolic health rather than acute intervention.

    Patients with rigid scheduling needs or who require Thursday availability should verify hours before booking, given the Thursday closure noted in the clinic data.


    How Serenity Wellness Compares to Nearby DeLand Options

    The most directly comparable competitor in the local dataset is Pure Alignment Chiropractic, also in DeLand, which carries a 5.0 rating across 165 Google reviews [source: competitor data]. The two practices serve overlapping but distinct patient populations. Pure Alignment focuses on chiropractic care; Serenity Wellness operates across a broader clinical and aesthetic spectrum.

    FeatureSerenity Wellness and Family PracticePure Alignment Chiropractic
    Google Rating4.95 (172 reviews)5.0 (165 reviews)
    Primary FocusIntegrative family practice + wellnessChiropractic
    Hormone ServicesYes (TRT, sexual health)Not listed
    Weight ManagementYes (medical, injections, body comp)Not listed
    IV / Infusion TherapyYes (NAD+, glutathione, vitamins)Not listed
    Aesthetics / SkinYesNot listed
    Hyperbaric OxygenYesNot listed
    LocationDeLand, FL 32720DeLand, FL

    For patients whose primary need is musculoskeletal or chiropractic care, Pure Alignment is the more direct option. For patients seeking a single-location solution for hormonal health, weight management, aesthetics, and family medicine, Serenity Wellness covers considerably more ground.


    Frequently Asked Questions, Grounded in Patient Review Patterns

    What is the general patient experience like at the first visit?

    The intake process draws consistently positive feedback, with 13 reviewers specifically describing their initial consultation in favorable terms. Patients report that the staff takes time to explain services and set realistic expectations before any treatment begins.

    “

    Wow, it was so nice to have everything explained to you about the different services. Everyone on the staff was so helpful. It was my consultation, and I am for sure going to use their services.

    N. J.·March 2026·Google

    New patients generally describe leaving their first appointment with a clear sense of what the treatment plan involves and what to expect next. The consultation appears to function as a genuine orientation rather than a sales process.


    How does the practice handle hormonal health concerns, particularly for women in perimenopause or menopause?

    This is one of the most consistently mentioned clinical strengths in the review data. Multiple patients described arriving after being dismissed or inadequately treated by other providers for perimenopausal and menopausal symptoms. The prescriber quality theme, which appeared in 36 reviews with zero negative sentiment, is heavily weighted toward hormonal health accounts.

    “

    Had my first visit today with Michelle. I felt valadated for how I have been feeling lately. She listened to my concerns and gave me a lot of information and communicated very clearly what my treatment plan could be and the expectations. So happy I made the appointment.

    K. N.·March 2026·Google

    Patients seeking hormonal support who have not found satisfactory care elsewhere appear to be a significant portion of the practice's patient base, based on the review patterns.


    Is the provider experience more personal than a typical doctor's office?

    Thirty-six reviewers flagged prescriber quality as a standout element, and several explicitly contrasted the experience with conventional medical settings.

    “

    Very friendly and professional. It was my first time going to this Doctors office and was very pleased. Doctors lately are becoming more impersonal but not here. Thank you for a great visit!

    T. J.·March 2026·Google

    The recurring language across reviews, "felt heard," "not rushed," "listened to my concerns," points to a practice culture that prioritizes visit depth over patient throughput.


    What does the weight loss program at this DeLand practice actually involve?

    The service menu includes medical weight loss protocols, B12 injections, lipotropic injections, and body composition analysis. Patient accounts suggest the program involves ongoing support and guidance, not just prescription or injection administration. The most detailed patient account in the review data describes a 105-pound loss over six months, with the reviewer crediting both the team's consistent support and her own effort. Results vary by individual, and no clinical describes the goal of are implied or appropriate.


    How does the support team, beyond the prescriber, contribute to the patient experience?

    Fifteen reviewers specifically called out the support team as a meaningful part of their care experience. Nutrition guidance, encouragement between visits, and scheduling flexibility all appear in this theme.

    “

    The entire office staff at Serenity go out of their way to make every visit the best. They are beyond accommodating on any schedule. They are great listeners and offer helpful tips to make a healthy journey possible. I was so surprised when I got a call that I had won a gift. They are a 10 out of 10.

    C. I.·March 2026·Google

    The practice appears to operate with a team-based model where the support staff carries meaningful clinical and motivational responsibility alongside the prescriber.


    What is the facility environment like?

    Twenty-nine reviewers mentioned the physical environment, with consistent descriptions of cleanliness, comfort, and a relaxed atmosphere. The word "relaxing" appears in multiple reviews, which aligns with the practice's positioning as a wellness-oriented space rather than a clinical waiting-room environment.

    “

    Excellent service and super relaxing

    H. C.·March 2026·Google

    Patients also noted that pricing is reasonable relative to the services offered, a point raised unprompted in the facility quality theme.


    How easy is it to get an appointment, and are there any known scheduling constraints?

    Scheduling drew positive feedback from the majority of the 12 reviewers who mentioned it, with patients describing the team as "beyond accommodating on any schedule." The practice is closed on Thursdays [source: clinic hours data], which is the one structural constraint in the scheduling data. Two reviewers expressed scheduling-related dissatisfaction, though the specifics are not detailed in the available review text. Prospective patients with limited weekday availability should confirm current scheduling options directly with the practice.


    Does the practice offer services for men, or is it primarily oriented toward women's health?

    The service menu includes testosterone replacement therapy, ED treatment, and broader sexual health services, which are primarily male-oriented offerings. The review data skews heavily toward female patient accounts, particularly around hormonal health, but the service list indicates the practice serves both populations. Patients seeking TRT or men's health services would benefit from a direct consultation to understand how those programs are structured.


    What IV therapy options are available, and what do patients report about them?

    The practice offers IV therapy, NAD+ therapy, glutathione infusions, and vitamin injections [source: service data]. Patient reviews do not extensively detail individual IV therapy outcomes, but the services appear within the broader "so many options to improve your well being" framing that multiple reviewers use to describe the practice's range. NAD+ and glutathione are increasingly common in integrative wellness settings; their inclusion alongside hyperbaric oxygen therapy suggests the practice is tracking developments in the longevity and recovery space.


    How does the practice handle communication between visits?

    Communication appeared in 38 reviews (22.1 percent), with 36 positive and 2 negative. Patients consistently describe staff as responsive, informative, and attentive to questions. The 2 negative communication-flagged reviews are not detailed in the available verbatim data, so the specific friction points are unknown. The overall pattern suggests communication is a strength, with isolated exceptions.

    “

    Always, friendly and most helpful! Staff are always nice and listen to your needs!

    m. b.·March 2026·Google

    Is this a good option for patients who have been dismissed or underserved elsewhere?

    The review data contains a notable cluster of patients who describe arriving at the practice after unsatisfying experiences with conventional providers, particularly around hormonal and menopausal symptoms. The language of "feeling heard" and "validated" appears across multiple independent reviews, suggesting the practice has developed a reputation for taking patient concerns seriously rather than routing them toward standard-of-care defaults.

    “

    Friendly, genuine staff. I felt appreciated, They walked me through the process. I felt better:) Thank you.

    J. T.·March 2026·Google

    For patients who have cycled through conventional care without resolution of chronic or hormonal symptoms, the practice appears to be a meaningful alternative worth consulting.


    Serenity Wellness and Family Practice [source: serenitywellnessfamilypractice.com] can be reached at (386) 873-4560. The practice is located at 890 N Boundary Ave, Suite 101, in DeLand, FL 32720. Thursday closures apply; current availability is best confirmed directly with the office.


    This is not a treatment recommendation. It is a directory entry. Any treatment decision belongs with a licensed physician who can examine the patient and evaluate their specific case.

    Also in DeLand
    • Pure Alignment Chiropractic

      5.0(165)
      Hair RestorationAesthetics
      View clinic →
    Contact
    (386) 873-4560Visit Website

    Hours

    • MonClosed
    • TueClosed
    • WedClosed
    • ThuClosed
    • FriClosed
    • SatClosed
    • SunClosed

    Address

    890 N Boundary Ave #101, DeLand, FL, 32720

    Get Directions
    Similar Clinics in FL

    Pure Alignment Chiropractic

    DeLand, FL
    5.0
    Medical Weight LossTRTAesthetics

    Healthy Glow Med Spa

    Orlando, FL
    5.0
    AestheticsSkin HealthTRT

    Horizons OBGYN & Aesthetics

    Winter Garden, FL
    5.0
    AestheticsSexual HealthPRP Therapy

    Face-Time Wellness

    Wildwood, FL
    5.0
    Peptide TherapyTRTMedical Weight Loss

    Castle Rock Hormone Health

    St. Augustine, FL
    5.0
    Hormone TestingED TreatmentTRT

    Stellar Performance Medical | Weight Loss & Hormone Specialists

    Ormond Beach, FL
    5.0
    ED TreatmentMedical Weight LossSexual Health
    View all clinics in FL
    Telehealth Option

    Prefer to start from home? Compare online TRT providers — including PeterMD.

    See all TRT & Testosterone providers

    Compare Online Providers

    • TRT & TestosteroneRecommended
    • HRT
    • Weight Loss
    • Peptide Therapy
    • ED & Sexual Health
    • Hair Loss
    • Blood Work
    • Mental Health
    Browse all →